- ENY2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90598
- Unconjugated
- 0.1 ml (also 25ul)
- DC6, Sus1, e(y)2
- Human
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- ENY2
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: AINQKLMETG ERERLKELLR AKLIECGWKD QLKAHCKEVI KEKGLEHVTV DDLVAEITPK GRALVPDSVK KELLQRIRT
- ENY2 transcription and export complex 2 subunit
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AINQKLMETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRT
Specifications/Features
Available conjugates: Unconjugated